PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn159891
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family HB-other
Protein Properties Length: 800aa    MW: 90510.2 Da    PI: 3.9744
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn159891genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.11.4e-08726776353
                 --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
    Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                  R +++k q+++L++++++++ p+ ++   + + ++L+ ++V  WF  +R+
  Achn159891 726 ARKRLKKVQVDTLQRVYARTKRPTNAMVSSIVHVTNLPRKRVVKWFEDKRT 776
                 58999*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.896721781IPR001356Homeobox domain
SuperFamilySSF466893.94E-9722785IPR009057Homeodomain-like
SMARTSM003896.2E-6723785IPR001356Homeobox domain
CDDcd000861.20E-6724775No hitNo description
PfamPF000463.7E-6726776IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.7E-8726778IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 800 aa     Download sequence    Send to blast
MAAASSFYSP MALRYLPAPY THRPSVSHLR ANLLLPRYPF RRPVVVFSRR RNKTISAITS  60
SNKNEQMVPR NESIKGDGVD ENALDSSFSL QEEDLENDDP SLAEFESELD KDLAELEREF  120
EDLAKLERLL DKALQALSDD EEEEEEDDDD DDDDEEKKQM MPYNEVTKED DVDEDALQSP  180
FTQKEEDLEN DDPSLAKLEL ELEGDLAKLE SEFEEDLAKL ERELDKVLQA LSDDEEEEEE  240
EEEEEDDDDN DGGEKLVMLP KNLDDVDEDA LEALENVDPS LAKLEREKLN HESEEDLAKL  300
ERALGNDELL EAFHSPENDE VNNKAEEEED DGYDDGANQR LNHNEVTKED DADPDALEAL  360
FSKLEEDLEN GDPYLDDGDG EIDEKDLAKL ERELVKALGD DKLLGAFDSL ENDEVNKKVE  420
DGDGDGDDDD DDDGDNDDDD GKKLVKLKNW QLRRLAYALK NGRRKISLNH ESEEDLAKLE  480
RALGNDELLE AFHSPENDEV NNKAEEEEDD GYDDGANQRL NHNEVTKEDD ADPDALEALF  540
SKLEEDLENG DPYLDDGDGE IDEKDLAKLE RELVKALGDD KLLGAFDSLE NDEVNKKVED  600
GDGDGDDDDD DDGDNDDDDG KKLVKLKNWQ LRRLAYALKN GRRKISIKNL AAELCLDRAV  660
VLQLLRNPPA SLLLMSAALP DKLISPISEP ESKPLETVSS EIVADVPQPE TDLVVPVHAM  720
QSSWSARKRL KKVQVDTLQR VYARTKRPTN AMVSSIVHVT NLPRKRVVKW FEDKRTEDGV  780
PDHRHPYQRS APQTVFKKK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1725733ARKRLKKVQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010648647.11e-100PREDICTED: retrotransposon-like protein 1
TrEMBLF6H3091e-103F6H309_VITVI; Putative uncharacterized protein
STRINGVIT_04s0008g05190.t011e-102(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA94282327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.12e-54overexpressor of cationic peroxidase 3